GenomeNet

>fcf:FNFX1_0398 hypothetical protein (EC:1.15.1.1); K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] (A)
MTAFYKLCGMSMLSLVLADCTFLSANKPYDRDHDGELIVHMKDVNTHKEVGTITISPYIH
DGNQEGMLITPHLYNLPANTTHGMHIHINPSCEDNGMAAGGHWDPDNTQKHLGPYNDNGH
KGDLPVLVVNADGTATEPVVAPKLNSLEELAGHSLMLHAGGDNYSDKPQPLGGGGARMWC
GVIAD

BLAST