GenomeNet

>fcf:FNFX1_1101 hypothetical protein (EC:2.7.1.21); K00857 thymidine kinase [EC:2.7.1.21] (A)
MDAGKTLDLLKVAYNYEDRGRKPLVLTSAIDKRAGLNKVKSRIGIDQDAYSLTDRDNIFE
FVENYNSSNKIDCVLIDEIHFFTQEQVWQLAEIVDELNIPVICYGLRTNYLGQPFETAAL
LLAIADTLEEVKTICHCGKKASFNMMVQNGKAIKQGNPIVVDDDSLKEIDTKYVSVCRKH
WKEGVYE

BLAST