GenomeNet

>ffo:FFONT_0933 K00169 pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1] | (GenBank) 2-oxoacid:ferredoxin oxidoreductase, alpha subunit (A)
MSSEIKNIPPVAIEKPKFKVWNGARAIAEAVKVADVDVISAYPIRPYTGIMNALASMIAN
GEFIADVVIADSEHSQFEIVKHASAVGARTFVGSSGVGLAYAAEAIIVTALSQLPVVGAI
GTRALDDPGNFGMEWSDVLMFRDYGWLISWAKTVQEAHDMTLVAYRVAEDKRVLLPHFVV
LDGAALTHVATPIVPVTKEQATDFLPPYKPPYRIDPIDGPVTKAQHIAPSLIGPEQRKLV
DVATKRAKEVIVEAWKDFATYTGREYPPFIEAIGMEDADFALIGMGAYMKDIEIVAKRMR
EKGVKIGTIRLRYVRPFPAEDLLRVIDGVKAAGVIEFGYSFGSPFGTGSLYHEIATSLYE
TNTRPELLDFLFLGGREPKVEHFMKAAEMIIESVHKKPQKKAYWLTLRGEDI

BLAST