GenomeNet

>fgr:FG00251.1 hypothetical protein (A)
MKPVYALTICLGLLEGADAIAIPEFVSPKVGYSTSLNHGEKKAESGSDANSSPRVFGAYG
PKSKLVGLPPVRRSDKTEESYGSDDGVDDDDQDDSGDNTADPPEDSPDSDDPELIYPEPM
MAPAYVHTGVLPVDKPEEAPKSKSSKVDTKSKSKSGSKPDDTVHTAKHGGDDDSESGSSG
KKKQKGKDKNKGNGDNPGKHSGDDDASKSRTKSEDSKPTSKLTTSNTSTSGTAPLPTSVN
TRPTTGRHSGDDDDKKSRSKTEDSPRSGSPKPTSTSDASSKGSGKGKGKGNDGSGKHSGD
DDATKTSSKKGSKDDSAKADDSKSAKSAFKKSSSTPRHPRGITATHQSGSTFDPNSAKGG
GKNGPGFFKPFEPPKLNNGYIQAVPPQASQKNSKSSPKVKPKPRLNGKVSGPFSSLRKRE
QLLSLRAAAPLESVTIDRSKWKATCDSVHEGDECQNAIDGNGDTIWHTQWEGTEPAPPHM
ITVDMKKVYNVNGISMLPRQDGSQNGYIAQHQVFLSKDNHNWGSPVAYGTWYSDYTTKYA
NFDTQPARYVRLVAITEANGGPWTSIAELNVYQGNDYTAPQPSSLGAWGPTVNFPVIPVA
GTVDPKTGKVLIWSSWARDTMDGGPGGLTLTSMWDPATGLVAERDVTETNHDMFCPGISL
DGNGQLVVTGGNNAERTSLFDPVKQAWIPGPDMKVARGYHASATTSTGKVFTIGGSWSGG
EYFKNGEVYDPKKKTWTLLNKADVQKMLTADTQGLFRSDNHAWLFGWKKGTVFQAGPSQA
MNWYYTDGKDGNVKTAGKRQSDRGVAPDAMCGNAIMFDAVKGKILTNGGTPNYQDSDATA
DAHIITINNPGNKADVSYASEGLYHARVFHSSVVLPNGNVFITGGQEYAIPFADSMPVLE
PEMYLPDEDRFVLMKPNNIVRTYHSIALLLPDGRVFNGGGGLCGGCDTNHFDAQLYTPPY
LYDSKGRLATRPKIASVSVSTVKVGGTVTVQTSGAVVRASLVRYGTATHTVNSDQRRVPL
TLSNAGKNSYSFQVPSDPGVALPGYWMLFVMDKNGVPSVASTIKVTVLQTYKGPGTVNPN
DLPLNALLAIQQAKCLRCL

BLAST