GenomeNet

>fgr:FG04829.1 hypothetical protein; K01556 kynureninase [EC:3.7.1.3] (A)
MELSSFVERLRSSAPPKFPSDANSLDFARNLDSQDKLSHLRDEFILPTKKSLKKKALDGS
IPNGHAQNGSVNGTNGHTNGQDDDQQCIYFVGNSLGAQPKAVREHLNAQLETWASVGVNG
HFSAMGNSPLPAWQDLAEDCAIRSADIVGASPHEIVIMNTLTANLHLLMASFYKPNEKRH
KVILEWKPFPSDHYAIESQVVWHGLDPEKSMVKIEPNEDHIITTDLILSTIDQHADDTAL
LLLPGIQYYSGQLFDIPRITAYAQAKGIVVGWDLAHAAGNVELKLHDWNVDFACWCTYKY
INAGPGSIAGAYVHERHGKVEMNSETGKASYRPRLMGWYGGDKSVRFNMDNNFIPTAGAG
GFQLSNPSAIDLASLSGALSVFNKTTMHDLRSKALVLTAYSEYLLDQILSESGDSELFRI
ITPRDPLQRGTQLSVLLKDGLLDNVSAALEENAVICDKRKPGVIRVAPVPLYSRFEDVWR
FMQILRGALKN

BLAST