GenomeNet

>fgr:FG08443.1 hypothetical protein; K00814 alanine transaminase [EC:2.6.1.2] (A)
MVNPPKQGQPSYELYKKEYDGIFTGLQERATALHKAFSQMEGVECAEPQGSMYLFPTINL
PAKAAEAAKAEGRSADEFYCMRLLEATGICVVPGSGFGQKENTLHFRTTFLAPGTEWVGR
IVKFHNEFLDKYR

BLAST