GenomeNet

>fgr:FG11164.1 hypothetical protein; K01312 trypsin [EC:3.4.21.4] (A)
MVKITSLVALAAPLVAAAPNPQNSPQIVGGTSASAGEFPFIVSITNNGGPWCGGTLLNAN
TVMTASHCVQGRSASAFAIRVGSNSRTSGGVTSRVSSIRMHPSFSGSTLNNDVALLKLST
SIPAGGSIAYGRLATSGSDPAAGSSLTVAGWGDTSEGGGVSPVNLLKVTVPVVSRATCRS
QYGTSAITDNMFCAGVTGGGKDACQGDSGGPIVDSSKTVVGIVSWGDGCARPNAAGVYAR
VGTLRSWIDSNA

BLAST