GenomeNet

>fjo:Fjoh_1256 K00164 2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2] | (GenBank) kgd; 2-oxoglutarate dehydrogenase, E1 subunit (A)
MDRFSFLNAAHTEFFAQLYDQYLVNPDSVEPSWRSFFQGFDFGQTTYNDENPVQTIVEYV
TSPNTDYSQVSDKLQKEFNVLKLIDGYRTRGHLFTKTNPVRDRRQSSPTLDIENFGLSTA
DLSTVFDAAQTIGMTPSSLEAIVNRLKAIYCQHIGIEYMYIRNPGVVKWIQDKLAVNVNQ
PNFSTEEKKTILNKLNEAVSFENFLHTKYVGQKRFSLEGGESIIPALDALIEQAAEKGVE
QFVMGMAHRGRLNVLANIFGKSTQDIFGEFDGKDYDQEYFDGDVKYHLGLTADKKTRSGK
SININLAPNPSHLETVGAVIEGITRAKQDKYYNDDFSKVLPIAVHGDAAIAGQGILYEII
QMAQLDGYKTGGTIHIVINNQVGFTTNYLDARSSTYCTDVAKVTLSPVLHVNADDAEAVV
HAVSFALDYRMQFGRDVFIDLLGYRKYGHNEGDEPRFTQPVLYKIIAKHKNPRDIYAEKL
LSDGVIDASYVNGLEKQYKSQLEENLEASRKKDLTIITPFMKNEWEGFVQVTDTQMLQKV
DTTFAKEGLDSIIKTISTLPEDKKFINKITKIVTDRKVGYDNNTLDWGTAEALAYGSLLT
EGFDVRISGQDVERGTFSHRHAVVKVEDSEEEVILLDAIENKKGKFGVFNSLLSEYGVLG
FDYGYALANPKALTIWEAQFGDFSNGAQIMIDQYISCGEDKWNNQNGIVLLLPHGYEGQG
AEHSSARMERYLQLCARHNMYVADCTTPANFFHLLRRQMKTNFRKPLVVFSPKSLLRDPR
CVSTVEELATGSFQETIDDTTVNKKDVKTLVFCTGKFYYDIVAERENNGRKDVAVVRIEQ
LFPFPVEQIKEIIAKYPNADDYVWAQEEPKNMGAYSFMLMNFDLVKWRLASLKAYSAPAS
GSYTRAKRRHADAIRMVFDKNLFR

BLAST