GenomeNet

>fpg:101914351 protein-glutamine gamma-glutamyltransferase 6-like; K05624 transglutaminase 6 [EC:2.3.2.13] (A)
MPEALKIENVNWHPKLNKAAHHTSDYSSTEAILRRGQAFNITLNLQTTVQAWDNLSFIAS
TGPSPTESQQTKVVFNLSEESASGWSAVLEPSEPGCMNLAISSPANAVIGRYKLKLQIVS
GNKVSSTLLGQFVLLFNPWCPNDDVFMANAKERQEYVLNDSGIIFQGLEKYIQQEAWNYG
QFEEDILDISLAILDRSLNHRQDPALDVSNRNNPVYVSRVISAMVNSNDEKGVVEGKWNG
KYRSGTNPLQWSGSVTILRKWYRGRYKPVRYGQCWVFAGVMCTVLRCLGIPTRVITNFNS
AHDRNINLSIDKYIDISGKTLHFTEDSVWNFHVWNESWFIRRDLGSFYDGWQVLDATPQE
TSKGIYQCGPASTKAIKEGDVNLDYDSSFVFAAVNADYVTWIHYSNKRKERIYSDTRKIG
KFISTKAVGSNSRVDVTANYKYPEGSLKERQVYKKALKLLGVRSTGKKAKMRRSRRRPSV
AQRQNTTQPAQKPSISGKVILDASPVIGQDILLTFALRNLLSDFKTIKVKLRASAILYTR
KPKAEILHLSRSIKLGSKEVKEIPFKISYSQYKNSLTDDRKILVTAVCETKQGASLLVEQ
DIVLQDPFLTIKVLGPTVVHKAVDVQVTFTNPLSEVVTDCVLRAEGSGLIKEQLRINVAR
MAPMESSTVQFEIIPYKSGTRQLQVDLVCIHFSDIKGFVMLDVAPVQ

BLAST