GenomeNet

>fri:FraEuI1c_4744 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) DNA polymerase LigD, ligase domain protein (A)
MSGDAPRGLDAYRGKRDAARTPEPVPEADPARHPRPDPAAPSDPAASGPAAAVDSQEAGP
VDHTGDDQAGRGDTFVIQEHHARALHWDFRLERDGVLVSWAVPRGLPVDRTANHLARQTE
DHPLEYAEFAGEIPKGEYGGGTVTIWDRGGYELESWTADKIKVTLHGSRVQGRYVLFRAG
GGRTTARQTTARQTTARQTTARQTGARAYGPDDWMVRRLDPPDDPTREPMPTTLAPMRAV
ASRELPAGPDWAYEVKWDGMRVLAFVDGGRVRARSRTGRDVTAAFPELRAVGLALGSTQA
VLDGEIVAFGPDGTPDFGRLAHRMHVADAAAARRLAGRIPVSYLVFDLLFLDGHPTTARS
YDERRALLARLPGLTLSETLAGDGPDVLRASAEAGLEGVIAKRRSAAYLPGRRGSDWVKV
KNTRTQSVVIGGWEPGAGKRADRVGSLLVGVAERPGLGEAPPGAPRFRYAGHVGTGFSDA
TLDLLGRLLAPLRRDEPPFADVPDAHVRAAVWVRPELVAEVAYAHWTADNRLRHPSFKGL
RDDLAPAETVVDGDTEPT

BLAST