GenomeNet

>fri:FraEuI1c_4744 DNA polymerase LigD, ligase domain-containing protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MSGDAPRGLDAYRGKRDAARTPEPVPEADPARHPRPDPAAPSDPAASGPAAAVDSQEAGP
VDHTGDDQAGRGDTFVIQEHHARALHWDFRLERDGVLVSWAVPRGLPVDRTANHLARQTE
DHPLEYAEFAGEIPKGEYGGGTVTIWDRGGYELESWTADKIKVTLHGSRVQGRYVLFRAG
GGRTTARQTTARQTTARQTTARQTGARAYGPDDWMVRRLDPPDDPTREPMPTTLAPMRAV
ASRELPAGPDWAYEVKWDGMRVLAFVDGGRVRARSRTGRDVTAAFPELRAVGLALGSTQA
VLDGEIVAFGPDGTPDFGRLAHRMHVADAAAARRLAGRIPVSYLVFDLLFLDGHPTTARS
YDERRALLARLPGLTLSETLAGDGPDVLRASAEAGLEGVIAKRRSAAYLPGRRGSDWVKV
KNTRTQSVVIGGWEPGAGKRADRVGSLLVGVAERPGLGEAPPGAPRFRYAGHVGTGFSDA
TLDLLGRLLAPLRRDEPPFADVPDAHVRAAVWVRPELVAEVAYAHWTADNRLRHPSFKGL
RDDLAPAETVVDGDTEPT

BLAST