GenomeNet

>fth:FTH_1691 tufA; protein-synthesizing GTPase (EC:3.6.5.3); K02358 elongation factor Tu (A)
MAKEKFERSKPHVNVGTIGHVDHGKTTLTAAITKVMAEKNGGMARKFDEIDSAPEEKARG
ITINTSHVEYESPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPKIVVFLNKCDMVDDEELLELVEMEVRELLDQYEFPGDDTPVIMGSALRAIE
GDEAYVEKIVELVQAMDDYIPAPERDTEKPFILPIEDVFSISGRGTVVTGRIERGVVNVG
DEVEVVGIRPTQKTTVTGVEMFRKLLDRGEAGDNVGILVRGLKRDDVERGQVLCKPGSIK
PHTKFEAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDITGAVELPEGVEMVMPGDNVKMT
ITLINPIAMDEGLRFAIREGGRTVGAGVVAKIIE

BLAST