GenomeNet

>fth:FTH_1691 K02358 elongation factor Tu | (GenBank) tufA; protein-synthesizing GTPase (A)
MAKEKFERSKPHVNVGTIGHVDHGKTTLTAAITKVMAEKNGGMARKFDEIDSAPEEKARG
ITINTSHVEYESPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPKIVVFLNKCDMVDDEELLELVEMEVRELLDQYEFPGDDTPVIMGSALRAIE
GDEAYVEKIVELVQAMDDYIPAPERDTEKPFILPIEDVFSISGRGTVVTGRIERGVVNVG
DEVEVVGIRPTQKTTVTGVEMFRKLLDRGEAGDNVGILVRGLKRDDVERGQVLCKPGSIK
PHTKFEAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDITGAVELPEGVEMVMPGDNVKMT
ITLINPIAMDEGLRFAIREGGRTVGAGVVAKIIE

BLAST