GenomeNet

>fve:101294444 LOW QUALITY PROTEIN: alpha-amylase-like; K01176 alpha-amylase [EC:3.2.1.1] (A)
MVVGWXSQGFNWESAKKGGWYNILEQSAAELASSGITHVWLPPPSQAISDEGYMPGRLYD
LTSKYGNQDGLKALVKAYQDNGIKSVADIVINHRCAEKQDERGIWCIFEGGTPDDRLDWG
PSLICSDDTKYSDGKGNPDTGADFGGAPDIDHKNTRVQSELSDWMNWLKTEIGFSGWRFD
FVRGYAPEFTKLYVANTKPSFSVGEYWNSIAYGSDGKPEYNQDNHRNELAGWIGNAGGEV
TAFDFTTKGILQAAVQGELWRLKDSNGGPPGLIGISPRNSVTFIDNHDTGSTQKLWPFPS
DKVMQGYAYTLTHPGIPSIFYDHFFDWGLKGEISKLTAIRSRNGIKPDSAVRILAADADL
YVASIDDKIITKIGPRFDVGNLVPPTFKIATSGKDYSVWEKSA

BLAST