GenomeNet

>gbm:Gbem_2204 sodA; superoxide dismutase, iron/manganese-containing protein; K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] (A)
MTAFTAKDYSRLIGMPGFSETLLNNHFTLYQGYVKNTNTLDDALTELRKSGKGSDPGFAE
LKRRFGWEFNGMRLHEYYFENLGGNQPINQDGRLASRIHQDFGGFDEWVQDFKSVGAMRG
IGWAIMYQDLSNGRLLNFWINEHDAGHPAGCTPVLIMDVFEHAFMTDYGLKRADYINAFF
QNIDWNSAEQRLQM

BLAST