GenomeNet

>gbr:Gbro_3099 protein-tyrosine phosphatase, low molecular weight; K01104 protein-tyrosine phosphatase [EC:3.1.3.48] (A)
MSERLHICFVCTGNICRSPMAQNIFLRALEEQGLTGEIRVSSCGTSGWHTGEPADNRART
ELLAHGYSDAHVAAQLGPEHYEADLLVAMDSGHVHELERKRLGDRVRLLRSFDPTADPAD
LDLSDPYYGGTEDFTVTREQIEKSMPGLVVWAVDRLA

BLAST