GenomeNet

>gbr:Gbro_3263 glycosyl transferase group 1 protein; K16150 glycogen(starch) synthase [EC:2.4.1.11] (A)
MKVLLVSWEYPPVVVGGLGRHVHHLATGLADAGHDVVVLTRRPSGTDAVSHPTIDTVAEG
VRVVAVAEDPPEFEFGADMMAWTLAMGHSFIRAGLRILAGERNSLSSTWTPDVVHAHDWL
VAHPAITLAEFFDCPLVTTIHATEAGRHSGWVSGRTNRQVHSVEWWLAAESDAIITCSES
MRDEVFRLFGSDAQLADIQVIHNGIDIRTWAFAPRAPRTGAPELLFAGRLEYEKGVQDLL
AALPRIRRTHPGTTLTVAGTGTQQEWLLEQARRHRISKAVTFLGAVGHDELVTLMHRCDA
IVLPSRYEPFGIVALEAAATGAPLVVSTAGGLGEAVTEPTTGLTFAPADVAGLATAVRAT
LGDPGAAAERARRARARLTAEFSWAEVAERTAGVYLAAKRRVRHPVGRPQIVERPLPERD
PSSDS

BLAST