GenomeNet

>gbr:Gbro_3272 DNA polymerase LigD, polymerase domain protein (A)
MSPDASAGEPVVLTVGDRPVRISSPDRVYFPERGETKMDLVEYYLSVGDGIVRALRERPC
MLHRFPKGVTGKKVHQKRVPAGAPDWLETTEIYFPRYGRTADELCVTELASVIWAVQMST
VEFHPWNSRRADPESPDEWRIDLDPMPDCPFSRIQRVAGVVHEVLDELGMRGFPKTSGGR
GLHIYVRIEPDWGFPDVRRAALAFAREVEWRAPDDVTTTWWRKDRDPAAVFVDYNQNTRD
HTMASAYSVRGNPRATVSAPVTWSEIDDIEPDDFTIATMPARFADLGDLHAEIDDVAHRI
DTLLAWAERDELDGDTSDGPESVDLDGS

BLAST