GenomeNet

>geb:GM18_0111 DNA ligase D; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MGLEEYQRKRDLTRTPEPAGKGGRSARTLRFVIHKHAASHLHYDFRLEIDGVLKSWAIPK
GPSLDPSVKRLSMMVEDHPYEYGDFEGVIPKGNYGAGEVIIWDAGTFHAAASEERELSLK
LLREGLQKGDLKFILHGEKLNGEFALVRIRSDKGNSWLLIKKHDRYAGTEDVTLKERSVV
SNATIEDVRAGRMPGRRVFAAQSGEARAGGPAPPPHPTSPLGGEEQSGTPSPGGGKRSEA
PMPRRVSPMLATSTAEPFDDPDWLFEIKLDGYRAIAEVSGREVALYSRNNLSFNKKFPSL
PGSLASLDVEAVFDGEVVALDENGRSYFQLLQNYRRTGKGNIAYFIFDLLYLNGEDLRNQ
PLLARKERLRTLLPDLPELRYSDHIMEYGREFFELARQNNLEGILAKRAASLYQTGRRSK
DWLKIKIRMQQEAVICGFTQPRRSRKGFGALVLGVYEDDRLVCIGFAGGGFDEAGLKEMY
ELLQPLVQPEPPFGTPVKSDMPITWVKPELVCEVEFSEWTDENVMRQPIFLGLREDKDPK
SVVRELVRSAATPPQPAAEPERRAQLPGATAKEPVAAGIPASRKGGSGKKGRDEVLILDG
HRLELTNLDKVFWPDEGYTKGDVIAYYRIMAHAMLPHLVDRPESLHRTPHGITEGGFFQK
EAGELPPSWITTREIYSKHVDKHIKFFVCQDEATLVYMANLGCIEINPWLSRLQHLDYPD
YFVIDLDPEDIPFAKVIETALAVREVLDRAGAVSFPKTSGATGMHIYVPLGAKYDYDTAG
GFAKVIATLAHHKVPDFTSLLRSPRLRQKKVYLDFLQNKPGQTLAAPYSIRPRPGATVSA
PLKWEEVKPGLDPGRFTIATMPGRLEHVGDLFSGVLGPGIDLERCIENLERG

BLAST