GenomeNet

>gem:GM21_2810 Aldehyde ferredoxin oxidoreductase (EC:1.2.7.5); K19515 benzoyl-CoA reductase subunit BamB [EC:1.3.-.-] (A)
MRYAETGYVLEVDLTKGNIERVATDPKDTELYLGGLGTNAKLLWDRVPADVDAFSPENLL
IFAAGLLCGTPATGCNRTIVSTISPQTKLMAFSMMGGFWAPELKYAGYDKVVLRGKSPKL
VYLYINNDKVEIRDASHLKGKGAIETAELIKKELNEPRAQVAAIGLAGENRVFYASIEQG
RSSASRGGIGAVMGDKGVKAVVVRGTKDLCVAKPEEFNDLCGEVLDYIKHREDNPIPDVM
PILAGLGSPQEMKVHDEKWHTENFNWGNARTRRKDFWTDEVSHAWEETMDKARTRLISCF
NCPMKCGATISMEGLPTYMMKCFTKLTYTMAAFSDLDFGLRMAQKATEYGLDGFSTPQVM
AFAMELLEKGILKQSDFPGMPEENDAKFFYLLDLIVNRQGIGDILAEGTYWAAQKIGNGA
EEYAHNNIKKHEQLPLKLSMLNPIYYLMYCTGEKINITQIEGQFPQAPYPTVEQREEFVK
DWVQVPDDKFKEIFLQWEPRGEKSMPHFPTVDMCCDIVDWQEMMHYIDDALGQCAGLSSF
PLKPPYHIHNYPKFISAGAGIEMDKDKLMKAAKRYRTLVRAFNIRRGMRRVDEQPPANHW
KNRFPELEKDLLDSYYKLKGWNEDGIPTKETLEELGLGYVAREFEKTGVYDGKPAVTAAA
AQQETLLSGGVQP

BLAST