GenomeNet

>gem:GM21_2810 K19515 benzoyl-CoA reductase subunit BamB [EC:1.3.-.-] | (GenBank) Aldehyde ferredoxin oxidoreductase (A)
MRYAETGYVLEVDLTKGNIERVATDPKDTELYLGGLGTNAKLLWDRVPADVDAFSPENLL
IFAAGLLCGTPATGCNRTIVSTISPQTKLMAFSMMGGFWAPELKYAGYDKVVLRGKSPKL
VYLYINNDKVEIRDASHLKGKGAIETAELIKKELNEPRAQVAAIGLAGENRVFYASIEQG
RSSASRGGIGAVMGDKGVKAVVVRGTKDLCVAKPEEFNDLCGEVLDYIKHREDNPIPDVM
PILAGLGSPQEMKVHDEKWHTENFNWGNARTRRKDFWTDEVSHAWEETMDKARTRLISCF
NCPMKCGATISMEGLPTYMMKCFTKLTYTMAAFSDLDFGLRMAQKATEYGLDGFSTPQVM
AFAMELLEKGILKQSDFPGMPEENDAKFFYLLDLIVNRQGIGDILAEGTYWAAQKIGNGA
EEYAHNNIKKHEQLPLKLSMLNPIYYLMYCTGEKINITQIEGQFPQAPYPTVEQREEFVK
DWVQVPDDKFKEIFLQWEPRGEKSMPHFPTVDMCCDIVDWQEMMHYIDDALGQCAGLSSF
PLKPPYHIHNYPKFISAGAGIEMDKDKLMKAAKRYRTLVRAFNIRRGMRRVDEQPPANHW
KNRFPELEKDLLDSYYKLKGWNEDGIPTKETLEELGLGYVAREFEKTGVYDGKPAVTAAA
AQQETLLSGGVQP

BLAST