GenomeNet

>gga:396432 TGM2, TGL2; transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase) (EC:2.3.2.13); K05625 transglutaminase 2 [EC:2.3.2.13] (A)
MGGPGPDGTMAEELVLETCDLQCERNGREHRTEEMGSQQLVVRRGQPFTITLNFAGRGYE
EGVDKLAFDVETGPCPVETSGTRSHFTLTDCPEEGTWSAVLQQQDGATLCVSLCSPSIAR
VGRYRLTLEASTGYQGSSFHLGDFVLLFNAWHPEDAVYLKEEDERREYVLSQQGLIYMGS
RDYITSTPWNFGQFEDEILAICLEMLDINPKFLRDQNLDCSRRNDPVYIGRVVSAMVNCN
DEDHGVLLGRWDNHYEDGMSPMAWIGSVDILKRWRRLGCQPVKYGQCWVFAAVACTVMRC
LGVPSRVVTNYNSAHDTNGNLVIDRYLSETGMEERRSTDMIWNFHCWVECWMTRPDLAPG
YDGWQALDPTPQEKSEGVYCCGPAPVKAIKEGDLQVQYDIPFVFAEVNADVVYWIVQSDG
EKKKSTHSSVVGKNISTKSVGRDSREDITHTYKYPEGSEKEREVFSKAEHEKSSLGEQEE
GLHMRIKLSEGANNGSDFDVFAFISNDTDKERECRLRLCARTASYNGEVGPQCGFKDLLN
LSLQPHMEQSVPLRILYEQYGPNLTQDNMIKVVALLTEYETGDSVVAIRDVYIQNPEIKI
RILGEPMQERKLVAEIRLVNPLAEPLNNCIFVVEGAGLTEGQRIEELEDPVEPQAEAKFR
MEFVPRQAGLHKLMVDFESDKLTGVKGYRNVIIAPLPK

BLAST