GenomeNet

>gga:396507 K00933 creatine kinase [EC:2.7.3.2] | (RefSeq) CKM; creatine kinase, muscle (A)
MPFSSTHNKHKLKFSAEEEFPDLSKHNNHMAKVLTPELYKRLRDKETPSGFTLDDVIQTG
VDNPGHPFIMTVGCVAGDEESYEVFKDLFDPVIQDRHGGYKPTDKHRTDLNHENLKGGDD
LDPKYVLSSRVRTGRSIKGYSLPPHCSRGERRAVEKLSVEALNSLEGEFKGRYYPLKAMT
EQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISM
EKGGNMKEVFRRFCVGLKKIEEIFKKAGHPFMWTEHLGYILTCPSNLGTGLRGGVHVKLP
KLSQHPKFEEILHRLRLQKRGTGGVDTAAVGAVFDISNADRLGFSEVEQVQMVVDGVKLM
VEMEKKLEQNQPIDDMIPAQK

BLAST