GenomeNet

>gga:416880 RP11-162P23.2, ALDH2; Uncharacterized protein [Source:UniProtKB/TrEMBL;Acc:F8VP50]; K00128 aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] (A)
MELTRAEVHRADRRKRALPEARPSRADTGRTRDGAGGREGGAERDRAAPGRAERHGGAGL
SAAQRSAAMLRLVGFASRLCRGQARQLSAAAASPIPAPNPSPEIAYNKIFINNEWHDAVS
KKTFPTVNPATGEVICQVAEGDKADVDKAVKAARAAFQLGSPWRRMDASHRGKLLNRLAD
LIERDRAYLAALETLDNGKPYSISYLVDLDMVVKCLRYFAGWSDKFHGKTIPLDGDFFCY
TRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLSALYVANLIKEAGF
PPGVVNIIPGYGPTAGAAISAHMDVDKVAFTGSTEVGHLIKKAAAESNLKRVTLELGGKS
PNIIMSDADMDWAVDQAHFALFFNQGQCCCAGSRTYVQEDIYNEFVERSVEKAKSRVVGN
PFDFKTEQGPQVDEEQFKKILGYISTGKREGAKLLCGGNPAADRGYFVQPTVFGDVQDNM
TIAREEIFGPVMQIMKFKTIEEIIERANNSKYGLAAAVFTKDIDKANYVSQALRAGTVWV
NCYNVFGAQAPFGGYKASGNGRELGEYGLEAYLEVKNVTIKIPQKNS

BLAST