GenomeNet

>gga:419953 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (RefSeq) ACE, DCP1; angiotensin I converting enzyme (EC:3.4.15.1) (A)
MPAALGLLLPWLSLVGALQPGLEPPQSDPTEAGAVFFASEYNSTAEIVLFRSVSASWEYN
TNLTTANAALQVEASLEEQNFTELWGKKAKELYGNIWSNFSDPQLKKIIGSIQTLGPSNL
PLDKRQQYNTILSDMDKIYSTAKVCLDNGTCWDLEPDISDIMATSRSYKKLLYAWEGWHN
AAGNPLRAKYQEFVTLSNEAYQMDGFEDTGSYWRSWYDSTTFEDDLEHLYNQLEPLYLNL
HAFVRRKLYDRYGPKYINLKGPIPAHLLGNMWAQQWNNIYDLMVPYPDKPNLDVTNTMVN
QGWNATHMFRVSEEFFTSLGLLEMPPEFWEKSMLEKPADGREVVCHASAWDFYNRKDFRI
KQCTTVTMEQLFTVHHEMGHVQYYLQYKDQPVSFRGGANPGFHEAIGDVLSLSVSTPSHL
QKIGLLSSAVEDEESNINYLLKMALEKIAFLPFGYLIDQWRWNVFSGRTPPSRYNYDWWY
LRTKYQGICAPVSRNESNFDPGAKYHIPGNTPYIRYFVSFILQFQFHKALCQAANHTGPL
HTCDIYMSKEAGAKLREVLKAGSSKSWQEILFNLTGTDKMDAGALLEYFSPVTTWLQEQN
NKTNEVLGWPEFDWRPPIPEGYPEGIDKIVDEAQAKEFLSEYNSTAEVVWNAYTEASWEY
NTNITDHNKEVMLEKNLAMSKHTIEYGMRARQFDPSDFQDETVTRILNKLSVLERAALPE
DELKEYNTLLSDMETTYSVAKVCRENNTCHPLDPDLTDILATSRDYNELLFAWKGWRDAS
GAKIKDKYKRYVELSNKAAVLNGYTDNGAYWRSLYETPTFEEDLERLYLQLQPLYLNLHA
YVRRALYNKYGAEHISLKGPIPAHLLGNMWAQSWSNIFDLVMPFPDATKVDATPAMKQQG
WTPKMMFEESDRFFTSLGLIPMPQEFWDKSMIEKPADGREVVCHASAWDFYNRKDFRIKQ
CTVVNMDDLITVHHEMGHVQYFLQYMDQPISFRDGANPGFHEAIGDVMALSVSTPKHLHS
INLLDQVTENEESDINYLMSIALDKIAFLPFGYLMDQWRWKVFDGRIKEDEYNQQWWNLR
LKYQGLCPPVPRSEDDFDPGAKFHIPANVPYIRYFVSFVIQFQFHQALCKAAGHTGPLHT
CDIYQSKEAGKLLGDAMKLGFSKPWPEAMQLITGQPNMSAEALMSYFEPLMTWLVKKNTE
NGEVLGWPEYSWTPYAVTEFHAATDTADFLGMSVGTKQATAGAWVLLALALVFLITSIFL
GVKLFSSRRKAFKSSSEMELK

BLAST