GenomeNet

>gga:420404 K11423 histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43] | (RefSeq) SETD2; SET domain containing 2 (A)
MGDFYDPEHPTPEEEENESKTETVQKAGFIKGPVFKGVASSRFLPKGTKTKVNLEEQGRQ
KVSFSFSLTKKTLPNRFLPGLGNEKQNETQNSPAVSLQTDFNPKIKMDLGDAAGSTEESS
PPKPKVELGKIHFKKHLLSVTTKPPPPAAAATLLPPPPALAPVTEPVAAAADFPSAPPPP
PTASPAAPMPVPTAAALPQLPVTLMSTLLLSPPVQAEVPASKEPCHVVPKEALELDPKQD
VVSHGLEEHLTQHVAEQVEVTPQKEDSHIGKDDEVSDSSKGASLCSRKQSSKRKFSQSDG
TLLGSESDEDSVRTSSSQRSHEQKISSAEKERDPRKSSSSLRGEELKSSSRSRSDRDEKY
SSYSKSERDSRYSSSRSRSDRERRRSRSHSRSRSDRSSRTSSSYSRSERSHYYESDRRYH
RSSPYRERTRYSRSYADSRGRESSDSEDEYRRTHSRSSDSRRTSSHSSYRESRTSYSKSD
RDSKVESSHADVERRGKSSKADRDSKRTSESEVTKRCSPLNELGYRKGTSHSKPDSNVNS
SRYKSTPSKIPAPKPDKFKSSFCCTESVEEIKQQSNSLDLETSCLKSNEIRVSIAKRFER
EKTLSPLNQLNDSPTFKKTDESKAAFPHSGSEELASNECHDSVKEQETLVRVKHEQLRTG
FPIEMNINGSPEGSSDDLAAPSASKAEDVAVSSDDSLCRLEASHVGRTSNSYPLPSNGFE
STYTPKEHEPDDSHVQSSECSSLFKEEEALVLEQQSEAMPLPVVNVDDSKISVNNLDDQA
APCDKTKEPVFCYVSDDATPSLYHSEVEIEVEPADVKVTSEPFLDLHVEPQTVTCDYEST
EDPNSKSACEVEQYHVNPPHQAGLAVDSSSRDSAQDCSSPRIRQDCPLVTQHLEENVPSE
GGGALPSCSGTGEVLELDVRHVDLNSAQGKLSLKDEHSYYSQVPLEHCSREEAAEEMAVT
TERVGPDDLKEQDQGASAEDDGGNEPLVASAFPDASFPSCDVVVAAEEPEAVTQAPTCDS
SGGTSEFAPAPHDDYSDTAESDSEPGSDDSDTEDTDSDDGVPRKRLQSVVVVPKNSSIAM
EDSSPCSSRSSQGARRYSDHWDDERPEPSRPYYEERPEATASNNGLQAESRCSPRGMEKS
PASSTELSRKDGEELRADACQPQSDGVDSTSQTDLAVDSQGKPNTDERMLNELMSIGRPL
GRQEEQPFCVPESFESTNESCHQMSFSKPDSWQGSGGLHQSGLGDCSREDGFHSVEGMGG
VSWELQAEKPSSTYQQPDSSFGVYSGYVYQPGTGAYSSSQNCWQGNGYWDARSAGRPAGG
NYERVQGQVPDSLTEDHEEYEDDRWDDECKAGFPSPSSKFHAPGQKETGSVQAHEISSNS
SKEPVSGTEKKEEVKALEKNDVKERGPPKKRRQELESDSESDADSRERKKVKVEGEQEVA
PQDSSMVGRPCIMDDFRDPQRWKEFAKQGKMPCYFDLIEENVYLTERKKSKSHRDIKRML
CECPPLSKEERAQGEVACGEDCLNRLLMIECSSRCPNGDYCSNRRFQKKQHADVEVILTE
KKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDAT
QKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKC
FCGSANCRGYLGGENRVSIRAAGGKMKKERSRKKDSVDGELEALLENGEGLSDKNQVLSL
SRLMVRIETLEQKLTCLKLIQNTHSQSCLKSFLECHGLSLLWIWMTELGDSRGSTANNLK
LQLEIMKTLELLPIPTKNMLEESKVLPIIQRWAQTKSAIPQLSEGDGYSSENTSRAHTPL
NTPELSAKQSAEGDTDTPKKLVFRRLKIISENSMDSAISDTTSELEGKEGKEDLDQLEVA
PTEVSEEQQPQQEVKVAVDTPVESSKPQELEAEPEVEVKESNGTKLEEPITMETPSQDEE
EGVSDVESERSQEQTDKIVDVSDLAIRLLDCWKDLKEVYRIPKKSQAEKESSADRGREAA
GLRDQTPTPKNPVLSRTDPEWQNLSKEKKRRRDSLSPPASAYERGTKRPEDRYDTPASKK
KVRLKDRNKLSTEERRKLFEQEVAQREAQKQQQQLQNLGITSPLPYDSMGYGTPHHSFIG
YPPGYPMQAYVDPSNPNAGKVLLPTPSMDSMCSPAAYEHPQPMVGHTVEPTLPTPQPVPV
VQHVATPMEVTTPQYVAQSDAVVHQEPNVAVLPVPTTGPVQGQSYGVWDSSQQTVAVQQQ
YSPAQSQPAIYYQGQTCQTVYGVTSPYSQTTPPIVQSYTQPGLQYIQGQQIYTAHPQGVI
VQPPPAVTTIVAAGQPQPIQQPELVVTNNLLDLPPPSPPKPKTIVLPPNWKTARDPEGKI
YYYHVVTRQTQWDPPTWDSPGDDASLEHEAEMDLGTPTYDENPMKSSKKPKTAEADTSSE
LAKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCK
NPEDLECNENVKHKTKEYIKKYMQKFGAIYKPKEDTDLE

BLAST