GenomeNet

>gga:423698 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) HKDC1; hexokinase domain containing 1 (A)
MFAVHLLAFHFAKLKEDQIKKVDRYLYHMRLSDDVLLDVMARFQAEMVKGLGRDTNPTAT
VKMLPSFVRSLPDGSEKGDFLAVDLGGSQFRALKVKVFNDGKQSSQLESEFYPTPKEVIQ
GSGAELFSYVADCLSDFMESRNLKHEKLPLGFTFSFPCKQTKLEEGILLSWTKHFKARGV
QGTDVVSSLRNALQKHKDIDVDVLAMVNDTVGTMMTCGYDDPRCEIGLIIGTGTNACYME
EMRHINLVEGDEGRMCINTEWGAFGDDGALDDLRTEFDRELDLGSLNPGKQLFEKMISSL
YLGELVRLILLKMTKEGLLFNGKVSAALLTKGKIEMKHVSAMEKYKEGLSNTKEILTELN
LFPSEDDCIAVQHVCTIVSFRSANLCAAALAAILTRLRENKKLLRLRTTVGIDGGLYKTH
PQYPKRLHKVVRRLVPNCDVRFLLSQSGSAKGAAMVTAVAHRLAAQRKKIDAVLAPFVLT
LETLRDVKNKMRTELEYGLKRETQDRATVKMLPTYVCGTPDGTEKGKYLALDLGGTNFRV
LLVKIRSGRRRSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLEYMGIKGARLPLGF
TFSFPCRQASIDKGTLVGWTKGFKATDCEGEDVVDMLREAIRRRNEFDLDIVAVVNDTVG
TMMTCGYEDPNCEIGLIAGTGSNVCYMEDMKNIEIVDGNEGKMCINTEWGGFGDNGCIDN
IRTKYDKEVDEGSLNAGKQRYEKMTSGMYLGEIVRQILIDLTKQGLLFRGQISESLRKRG
IFETKFLSQIESDRLALLQVRRILQQLGLDSTCDDSIIVKEVCGAVSRRAAQLCGAGLAA
IVEKKRENRGAEHLQITVGVDGTLYKLHPHFSRVLQETVKELAPRCDVTFMLSEDGSGKG
AALITAVAKRLHNIGQK

BLAST