GenomeNet

>ggo:101124677 uncharacterized protein LOC101124677; K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] (A)
MAPPPYCSYSSTGAPALEFDKCLEKGVCPWGGGPALSSRPPNFSPQMSSNRPVEIVEDPR
VVGIWTKNKELELSVPKFKIDEFYVGPVPPKQVTFAKLNDNIRENFLRDMCKKYGEVEEV
EILYNPKTKKHLGIAKVVFATVRGAKDAVQHLHSTSVMGNIIHVELDTKGEPGRGGADRS
TSPALESARCSLELAGEAIPPTLWVFGGPCRTKGLAGLEGIPRSLSDALKRLKDGGLSAG
CGSGSSSVTPNSGGTPFSQDTAYSSCRLDTPNSYGQGTPLTPRLGTPFSQDSSYSSRQPT
PSYLFSQDPAVTFKARRHESKFTDAYNRRHEHHYVHNSPAVTAVAGAAAAFRGSSDLPFG
AVGSTGGSSGPPFKAQPQDSATFAHTPPPAQATPAPGFKSAFSPYQTPVAHFPPPPEEPT
ATAAFGARDSGEFRRAPAPPPLPPAEPLAKEKPGTPPGPPPPDTNSMELGGRPTFGWSPE
PCDSPGTPTLESSPAGPEKPHDSLDSRIEMLLKQQRTKLLFLREPDSDTELQMEGSPISS
SSSQLSPLAPFGTNSQPGFRGPTPPSSRPSSTGLEDISPTPLPDSDEDEELDLGLGPRPP
PEPGPPDPAGLLGQTAEVALDLVGDRTPTSEKMDEGQQSSGEDMEISDDEMPSAPITSAD
CPKPMVVTPGAAAVAAPSVLAPTLPLPPPPGFPPLPPPPPPPPPQPGFPMPPPLPPPPPP
PPPAHPAVTVPPPPLPAPPGVPPPPILPPLPPFPPGLFPVMQVDMSHVLGGQWGGMPMSF
QMQTQVLSRLMTGQGACPYPPFMAAAAAAASTGLQFVNLPPYRGPFSLSNSGPGRGQHWP
PLPKFDPSVPPPGYMPRQEDPHKATVDGVLLVVLKELKAIMKRDLNRKMVEVVAFRAFDE
WWDKKERMAKASLTPVKSGEHKDEDRPKPKDRIASCLLESWGKGEGLGYEGLGLGIGLRG
AIRLPSFKVKRKEPPDTTSSGDQKRLRPSTSVDEEDEESERERDRDMADTPCELAKRDPK
GVGVRRRPARPLELDSGGEEXXXXDEKESLSASSSSSASSSSGSSTTSPSSSASDKEEEQ
ESTEEEEEAEEEEEVPRSQLSSSSTSSTSDKDDDDDDSDDRDESENDDEDTALSEASEKG
EGDSDEEETVSIVTSKAEATSSSESSESSEFESSSESSPSSSEDEEEVVAREEEEEEEEE
EMVAEESMASAGPEDFEQDGEEAALAPGAPAVDSLGMEEEVDIETEAVAPEERPSMLDEP
PLPVGVEEPADSREPPEEPGLSQEGAMLLSPEPPAREVEAQPPLSPERAPEHDLEVEPEP
PTMLPLPLQPPLPPPRPPRPPSPPPEPETTDAPHPSVPPEPPAEDHPPHTPGLCGSLAKS
QSTETVPATPGGEPPLSGGSSGLSLSSPQVPGSPFSYPAPSPSLSSGGLPRTPGRDFSFT
PTFSEPSGPLLLPVCPLPTGRRDERSGPLASPVLLETGLPLPLPLPLPLPLALPAVLRAQ
ARAPTPLPPLLPAPLASCPPPMKRKPGRPRRSPPSMLSLDGXXXXPPPPPPPPPVEPTKL
PFKELDNQWPSEVIPPGPRGRDEVTEEYMELAKSRGPWRRPPKKRHEDLVPPAGSPELSP
PQPLFRPRSEFEEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPS
TSLSSAKKKKRDDGIREHVTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPADTQGMSIP
AQPHASTRAGSERRSEQRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAM
EPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFI
NHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGT
LN

BLAST