GenomeNet

>ggo:101138298 TGM4; LOW QUALITY PROTEIN: protein-glutamine gamma-glutamyltransferase 4; K05621 transglutaminase 4 [EC:2.3.2.13] (A)
MDASKELQVLHIDFLKQDNAVSHHTWEFQTSSPVFRRGQVFHLRLVLNQPLQSYHQLKLE
FSTGPNPSIAKHTLVVLDPRTPSDHYNWQATLQNESGKEVTVAVTSSPNAILGKYQLNVK
TGNHILKSEENILYLLFNPWCKEDMVFMPDEDERKEYILNDTGCHYVGAARSIKYKPWNF
GQFEKNVLDCCISLLTESSLKPTDRRDPVLVCRAMCAMMSFEKGQGMLIGNWTGDYEGGT
APYKWTGCAPILQQYYNTKQAVCFGQCWXILTTVLRALGIPARSVTAFDSTHDTERNLTV
DTYVNENGEKITNMTHDSVWNFHVWTDAWMKRPDLPKGYDGWQAVDATPQERSQGVFCCG
PSPLTAICKGDIFIVYDTRFVFSEVNGDRLIWLVKMVNGQEELHVISMETTSIWKNISTK
AVGQDRWRDITYEYEYPEGSSEERQVMDHAFLLLSSEREHRRPVKENFLHMSVQSDDVLL
GNPVNFTVILKRKTAALQNVNISGSFELQLYTGKKVAKLCDLNKTSQIQGQVSEVTLTLD
SKTYINSLAILDDEPVIRGFIIAEIVESEEIMASEVFTSFQYPEFSIELPNTGRIGQLLV
CNCIFKNTLAIPLTDVKFSLESLGISSLQTSDHETVQPGETIQSQIKCTPIKTGPKKFIV
KLSSKQVKEINAQKIVLITK

BLAST