GenomeNet

>ggo:101143373 TGM6; protein-glutamine gamma-glutamyltransferase 6; K05624 transglutaminase 6 [EC:2.3.2.13] (A)
MFVAYNMLQSKQGTLWKPEGEVRLAAVCQSGIRVTKVDWQRSRNGAAHHTQEYPCPELVV
RRGQSFSLTLELSRALDCEEILIFTVETGPRASEALHTKAVFQTSELERGEGWTAAREAQ
MENTLTVSLASPPSAVVGRYLLSIRLSSHRKHSNRRLGEFVLLFNPWCAEDDVFLASEEE
RQEYVLNDSGIIFRGVEKHIRAQGWNYGQFEEGILNICLSILDRSPGHQNNPATDVSCRH
NPIYVTRVISAMVNSNNDRGVVQGQWQGKYGGGTSPLHWRGSVAILQKWLKGRYKPVKYG
QCWVFAGVMCTVLRCLGIATRVVSNFNSAHDTDQNLSVDKYVDSFGRTLEDMTEDSMWNF
HVWNESWFARQDLGPSYNGWQVLDATPQEESEGVFRCGPASVTAIREGDVHLAHDGPFVF
AEVNADYITWLWHEDESRERVYSNTKKIGRCISTKAVGSDSRVDITDLYKYPEGSRKERQ
VYSKAVNRLFGVEASGRRTWIRRAGGRCLWRDDLLEPATKPSIAGKFKVLEPPMLGRDLR
LALCLANLTSRAQRMRVNLSGATILYTRKPVAEILHESHAVRLGPQEEKRIPITISYSKY
KEDLTEDKKILLAAMCLVTKGEKLLVEKDITLEDFITIKVLGPAMVGVAVTVEVTVVNPL
LERVKDCALMVEGSGLLQEQLSIDVPTLEPQERASVQFDITPSKSGPRQLQVDLVSPHFP
DIKGFVIVHVATAK

BLAST