GenomeNet

>ggo:101149948 TGM7; protein-glutamine gamma-glutamyltransferase Z; K05623 transglutaminase 7 [EC:2.3.2.13] (A)
MDQVATLQLESVDLQSSRNNKEHHTQEMGVKRLTVRRGQPFYLRLSFSRPFQSQNDHITF
VAETGPKPSELLGTRATFFLTRVQPGNVWSASDFTIDSNSLQVSLFTPANAVIGHYTLKI
EISQGQGHSVTYLLGTFILLFNPWSPEDDVYLPSEILLQEYIMRDYGFVYKGHERFITSW
PWNYGQFEEDIIDICFEILNKSLYHLKNPAKDCSQRNDVVYVCRVVSAMINSNDDNGVLQ
GNWGEDYSKGVSPLEWNGSVAILQQWSARGGQPVKYGQCWVFASVMCTVMRCLGVPTRVV
SNFRSAHNVDRNLTIDTYYNRNAEMLSTQKRDKIWNFHVWNECWMIRKDLPPGYNGWQVL
DPTPQQTSSGLFCCGPASVKAIREGDVHLAYDTPFVYAEVNADEVIWLLGDGQAQEILAH
NTSSIGKEISTKMVGSDQRQSITSSYKYPEGSPEERAVFMKASRKMLGPQRASLPFLDLL
ESGGLRDQPAQLQLHLARIPDWGQDLQLLLRIQRVPDSTHPRGPIGLVVRFCAQALLHGG
GTQKPFWRHTVRMNLDFGKETQWPLLLPYSNYRNKLTDEKLIRVSGIAEVEETGRSMLVL
KDICLEPPHLSIEVSERAEVGKALRLHVTLTNTLMVALSSCTMVLEGSGLINGQIAKDLG
TLVAGHTLQIQLDLYPTKAGPRQLQVLISSNEVKEIKGYKDIFVTVAGAP

BLAST