GenomeNet

>ggo:101150288 NEU3; LOW QUALITY PROTEIN: sialidase-3; K12357 sialidase-2/3/4 [EC:3.2.1.18] (A)
MLWTSGPFCRVPSEAGNVCSTLRLSREALGGDTELQTNIRARGCGTEERRRPLGTEVGPG
LELSWRGWRWCRSHAVVGTELRAGGRGSAEGAGRXRARGVGQRLAPTATDYSLRPPLFVA
VTCFRQSTRSSLLGACLRVLRLCCFSLSILCLSLPSLGAGASPGLRRMRPADLPPRPMEE
SPASSSAPTETEEPGSSAEVMEEVTTCSFNSPLFRQEDDRGITYRIPALLYIPPTHTFLA
FAEKRSTRRDEDALHLVLRRGLRIGQLVQWGPLKPLMEATLPGHRTMNPCPVWEQKSGCV
FLFFICVRGHVTERQQIVSGRNAARLCFIYSQDAGCSWSEVRDLTEEVIGSELKHWATFA
VGPGHGIQLQSGRLVIPAYTYYIPSWFFCFQLPCKTRPHSLMIYSDDLGVTWHHGRLIRP
MVTVECEVAEVTGRAGHPVLYCSARTPNRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQ
GSVVSFRPLEIPHRCQDSNSKDAPTIQQSSPGSSLRLEEEAGTPSESWLLYSHPTSRKQR
VDLGIYLNQTPLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFECGTKQECEQIAFR
LFTHWEILSHLQGDCTSPGRNPSQFKSN

BLAST