GenomeNet

>gka:GK2914 transglutaminase (protein-glutamine gamma-glutamyltransferase) (EC:2.3.2.13); K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] (A)
MIRVLSPINFDVSSSFSLPASEQRILDALVSSPKLYTYANKHQLRFEIALRDRIVRAAGE
LAKSRARFAIFRFSRCNSDFWTRDERGGFRLRPDVTASEAIQDIFVHSERYAFECATAIV
IVFYKAVLDVIDPAAFNRLFADLLLYDWHTDRDLGIQTKKDEHFLPGDCLYFKNPEFDPL
TPQWQGENAIYLGDGFFYGHGIGIQTKEGIIAALNRKRKRGATKSAYLLPDITQVDFAYL
SQFARGFDEFRLPIRRSSFIFGTLGSAAFLHR

BLAST