GenomeNet

>gka:GK2914 K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] | (GenBank) transglutaminase (protein-glutamine gamma-glutamyltransferase) (A)
MIRVLSPINFDVSSSFSLPASEQRILDALVSSPKLYTYANKHQLRFEIALRDRIVRAAGE
LAKSRARFAIFRFSRCNSDFWTRDERGGFRLRPDVTASEAIQDIFVHSERYAFECATAIV
IVFYKAVLDVIDPAAFNRLFADLLLYDWHTDRDLGIQTKKDEHFLPGDCLYFKNPEFDPL
TPQWQGENAIYLGDGFFYGHGIGIQTKEGIIAALNRKRKRGATKSAYLLPDITQVDFAYL
SQFARGFDEFRLPIRRSSFIFGTLGSAAFLHR

BLAST