GenomeNet

>gla:GL50803_8364 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) Thymidine kinase (A)
MNSLTLILGPMFAGKSTELVGIHARLVAAHKRVLVVKHTFDTRYDDNSLTTHDNTRIAAK
RAVLLGELATEFGDYDALIVDEGQFFADIVSGVQDALSKGLYVYVSALSGNFKREPFELI
PRLFPLASAIYLRSAICAICHAPAPFSARFSAQTEEIVIGGAELYAPTCRTCWKSIAHQR
SIKKARQLTDSEIKSFVSDAAAILERSALTGSKLLLVPAVTSPLDAELQCVYASASSAGQ
NILVIAREESQELNEAASTFGFTLRYVDSLVQSESEDDCTINNEVKHAMDPHSIVLVYHA
DSYDHADVVLDDCVFQGKVVIAATSAKAPYQVLGSFLSHADIVSFGSLTRNTGEGHEKLG
ASGVSTEVPRFFRTCLAGLPLEKLVLGINEDL

BLAST