GenomeNet

>gmc:GY4MC1_0649 K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] | (GenBank) Protein-glutamine gamma-glutamyltransferase (EC:2.3.2.13) (A)
MIQIQQTIVNNDFLAHSSLSKKQEKIFEALLKSQKTYVYKNKHQLLFEIILRDRIIDAAI
LLAKSKARFTIFRFSRCNEQFWTKNDLGGFQLKQGILPSDAINDIFINSQLYAFECATAI
VIVFYKAVLDVIDKQKFNTLFSNLLLYDWHVDEDLGIKTKKGEDYLPGDCLYFKNPDFDP
QTPQWQGENTIYLGNGLHYGHGIGIKTKEEIIDTLNRKRKRNATKSAYLLPQTTRVNFIY
LSQFANSLENYRLPINHQYFITGALGSATFLHW

BLAST