GenomeNet

>gmc:GY4MC1_3723 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) Thymidine kinase (A)
MYVMKQSGWLEVICGSMFSGKSEELIRRVRRATFAKQDVKVFKPTIDNRYSEEAVVSHNG
NSVIAIPVSSPQEIFEHISEKTDVIAIDEVQFFSDDIIEVVQTLADRGYRVIVAGLDQDF
RGEPFGPVPTLMAIAESVTKLQAVCTVCGSPASRTQRLINGVPASYHDPVILVGASESYE
PRCRHHHEVPDKPVKNCQTDNHHVR

BLAST