GenomeNet

>gme:Gmet_2087 K19515 benzoyl-CoA reductase subunit BamB [EC:1.3.-.-] | (GenBank) bamB-1; benzoyl-CoA reductase, putative (A)
MRYAETGYVLEVDLTKGSIERVATDPRDTELYLGGLGTNAKILWDRVPPEVEPFSPENLL
IFAAGLLCGTPATGCNRTIVSTVSPQTKLMAFSMMGGFWAPELKYAGYDKIIFRGKSPEL
VYLYINNDKVEIRDASHLKGKGAIETAEIIKKELNEPRAQVAAIGKAGENRVFYASIEQG
RSSASRGGIGAVMGDKGLKAVVVRGTKDLCVAKPEEYIGLCNEVLDYIKHREENPIPDVM
PILAGLGSPQEMKVHDEKWHTENFNWGNARTRRKDFWTDEVSHAWEKTMDKARTRLISCY
NCPMKCGATISMEGLPTYMMKCFTKLTYTMAAYSDLDFGLRIAQKATEYGLDGFSAPQVM
AFAFELLEKGILKDSDFPGLPEGNEERFFYLLDKIVNRDGIGDILANGTYWAAQEIGNGA
EDYAHNNIKKHEQLPLKLSMLNPIYYLMYCTGEKINITQIEGQFPQAPYPKLEQREAFVE
DWIQVPDEKFKKIFLEWEPRGEKSMPNFPTVDMCCDIVDWQEMMHYIDDALGQCAGLSSF
PLKPPYHIHNYPKFIAAGAGIEMDTEKLKKAAKRYRTLVRAFNIRRGMRRVDEQPPANHW
KNRFPELEKELLDSYYKLKGWNDDGIPTKETLDDLGLGYVGDEFIKRGILSAG

BLAST