GenomeNet

>gmx:100781341 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) thymidine kinase-like (A)
MASSSPSSLSLDTAKDLSHSFSEVHVIIGPMFAGKTTALLRRIKSELNAANNVALLKSSK
DTRYAIDSVVTHDGIKFPCWALPDLLSFREKYGEDAYQKLDVIGIDEAQFFVDLYEFCCK
AADEDGKTVIVAGLDGEYLRRSFGSVLHIIPLAESVTKLTARCELCGKRAFFTLRKTEQR
ETELIGGADVYMPVCRLHYINSQVAERSVLESENEKTDSLLEAATDV

BLAST