GenomeNet

>gmx:100802169 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial (A)
MWRCVARAIRVPASERSIPNHQPLRSHISRFFSGGGGGGSSSYNVVDHKYDAVVVGAGGA
GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW
LGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGRIYQRAFGGQSLNFGKGGQAYRCACA
ADRTGHALLHTLYGQAMRHNTQFFVEYFALDLLMNSDGTCQGVIALNMEDGTLHHFQASS
TILATGGYGRAYFSATSAHTCTGDGNAMVARAGIPLEDLEFVQFHPTGIYGAGCLITEGS
RGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHL
PPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVITIKGDDPDA
VVPGLMAAGETACASVHGANRLGANSLLDIVVFGRACANRVSEIQRPGEKQKPLEKDAGM
KTIAWLDKLRNSNGSLPTSKIRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFHDVK
LKDRSLIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDEKWMKHTL
GYWDNEKVRLDYRPVHMNTLDDEVESFPPKARVY

BLAST