GenomeNet

>gmx:547605 ribulose-1,5-bisphosphate carboxylase small subunit rbcS2; K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MASSMISSPAVTTVNRAGAGMVAPFTGLKSMAGFPTRKTNNDTISIASNGGRVQCMQVWP
PVGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGR
YWTMWKLPMFGCTDASQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKPPGF

BLAST