GenomeNet

>gmx:547616 MAPK2, GmMAPK2; mitogen-activated protein kinase 2; K14512 mitogen-activated protein kinase 6 [EC:2.7.11.24] (A)
MEGGGAAPPADTVMSDAAPPPQQAMAMGIENIPATLSHGGRFIQYNIFGNIFEVTAKYKP
PIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMDHENVVA
IRDIVPPPQREIFNDVYIAYELMDTDLHQIIRSNQGLSEEHCQYFLYQILRGLKYIHSAN
VLHRDLKPSNLLLNANCDLKICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAA
IDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPSEADLGFLNENAKRYIRQLPL
YRRQSFQEKFPHVHPEAIDLVEKMLTFDPRKRITVEDALAHPYLTSLHDISDEPVCMTPF
NFDFEQHALTEEQMKELIYREALAFNPEYQQ

BLAST