GenomeNet

>gmx:547724 GAD; GAD protein; K01580 glutamate decarboxylase [EC:4.1.1.15] (A)
MVLSKTASESDVSVHSTFASRYVRTSLPRFKMAEESIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLEETEAAVG
VGTVGSSEAIMLAGLAFKRKWQNRRKQEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLRDDYYVMDPEKAVELVDENTICVAAILGSTLNGEFEDVKRLNDLLIEKNKITGWDTP
IHVDAASGGFIAPFIYPELEWDFRLQLVKSINVSGHKYGLVYAGIGWVIWRSKQDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMENCRDNMLVLKEGLEK
TGRFSIVSKDNGVPLVAFTLKDHTHFDEFQISDFLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLAERLVSDVEKVLHELDSLPARVISSTTVTLSAEENGKVVVAKKNPMETQRE
ITAIWKKFVLERKKNNDKMNGVC

BLAST