GenomeNet

>gob:Gobs_2120 DNA polymerase LigD; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MPTRGSARRPTPPAGEPFVVTEHPSSGAELRLERNGVPCCWDLPEGPPAARGRALPAVPT
MGGDGGGLPTWDAGRYAVEQWTDDRVVVVLAGRRLRGRHVLFRSPDGGWSVRALDAPAEG
APLVPMLATAGELPPSAQDHDWGYEFKWDGVRALAVVEAGGLALWARSGTDITVRYPELS
LPTALTGHDAVVDGEVVALDARGRPDFGALQGRMHRTGPEVRRMAATTPVTYLVFDLLAW
EGESLLALPYAQRRERLEALGVAGERWVPTPWFRGGGAAVLAASRDNGLEGIVAKRLDSP
YRPGLRGPDWRKVKNVRTQAVVVGGWRPGQGRRAGGVGSLLVGVHDDAGRLVYAGHVGTG
FTAAALAELQPLFTPAHRPPFADALPREVTRDARWVAPELVGEVAFAAWTADGRMRHPSW
RGLRDDLAPEDVVEEW

BLAST