GenomeNet

>gor:KTR9_0340 Glutamate decarboxylase-related PLP-dependent protein; K01580 glutamate decarboxylase [EC:4.1.1.15] (A)
MTTDEGVHNQSGGARATTNIGDAMSLRTVFTRTGEATELPKFSLSDSMLLPETAYQIVHD
EAMLDGNARLNLATFVSTWMDGEAQKLYAETVDKNMIDKDEYPQTAAIEDRCWRILADLW
HNPDVENAIGTSTIGSSEACMLGGLALKRHWQTRRRAEGKSTENPNIVLSTAVQVCWEKF
CNYFEVEPKWVPISPDHLVLDGHELEKYVDENTIGVVAIMGQTYTGMYEPVTAIAAKLDE
IQADTGLDVKIHIDGASGAMIAPFCQPDLEWDFRVDRVVSINTSGHKYGLVYPGVGWIVW
RDTEALPESMVFHCSYLGGDMPTLALNFSRPGAQVLLQYYMFLRLGRDGFTQVQQGSLDV
AQWLSSQIAQIDGLELVSKGDTIPVFAWKLKAGHTENWNLYDLSDRLRMKGWLVPAYPMA
DDLADLTVQRIVVRAGLSHDLARALIADIETEVQFLDRLESPMPREGDGSHFHH

BLAST