GenomeNet

>gor:KTR9_0340 K01580 glutamate decarboxylase [EC:4.1.1.15] | (GenBank) Glutamate decarboxylase-related PLP-dependent protein (A)
MTTDEGVHNQSGGARATTNIGDAMSLRTVFTRTGEATELPKFSLSDSMLLPETAYQIVHD
EAMLDGNARLNLATFVSTWMDGEAQKLYAETVDKNMIDKDEYPQTAAIEDRCWRILADLW
HNPDVENAIGTSTIGSSEACMLGGLALKRHWQTRRRAEGKSTENPNIVLSTAVQVCWEKF
CNYFEVEPKWVPISPDHLVLDGHELEKYVDENTIGVVAIMGQTYTGMYEPVTAIAAKLDE
IQADTGLDVKIHIDGASGAMIAPFCQPDLEWDFRVDRVVSINTSGHKYGLVYPGVGWIVW
RDTEALPESMVFHCSYLGGDMPTLALNFSRPGAQVLLQYYMFLRLGRDGFTQVQQGSLDV
AQWLSSQIAQIDGLELVSKGDTIPVFAWKLKAGHTENWNLYDLSDRLRMKGWLVPAYPMA
DDLADLTVQRIVVRAGLSHDLARALIADIETEVQFLDRLESPMPREGDGSHFHH

BLAST