GenomeNet

>gor:KTR9_0351 DNA primase, small subunit; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MTMASRSPAEELDVDGVAVRMSNPDKIYFPELGENGGRKRDLVGYYRTVALGVGEDSEGP
LMRAARDRPTFLQRFPDGVEGEEIYQKHIAKKRPEHVQSTPIVFPSKRTGDAIRPTVPAD
LVWGANLGTVTFHTWPTLHPDNDHPDQLRIDLDPQPGTTFDDVRRVAIEGLKPLLDELGF
TGFVKTSGGRGVHVYVPIEPLWDFIATRRCVIAIARELERRDPDAVTPSWWKEERGERIF
IDFNQNARDRTMASPYSVRRSARARVSTPVTWDELADVDPDDCTIATVPKLLADRGDPWA
DIADHRRGIEKLLEMVQADDANGLGDMPYPPSYPKMPGEPPRVQPSKKVAEHWDEKGNRR
SDG

BLAST