GenomeNet

>gor:KTR9_0351 no KO assigned | (GenBank) DNA primase, small subunit (A)
MTMASRSPAEELDVDGVAVRMSNPDKIYFPELGENGGRKRDLVGYYRTVALGVGEDSEGP
LMRAARDRPTFLQRFPDGVEGEEIYQKHIAKKRPEHVQSTPIVFPSKRTGDAIRPTVPAD
LVWGANLGTVTFHTWPTLHPDNDHPDQLRIDLDPQPGTTFDDVRRVAIEGLKPLLDELGF
TGFVKTSGGRGVHVYVPIEPLWDFIATRRCVIAIARELERRDPDAVTPSWWKEERGERIF
IDFNQNARDRTMASPYSVRRSARARVSTPVTWDELADVDPDDCTIATVPKLLADRGDPWA
DIADHRRGIEKLLEMVQADDANGLGDMPYPPSYPKMPGEPPRVQPSKKVAEHWDEKGNRR
SDG

BLAST