GenomeNet

>gth:Geoth_2861 dihydrolipoyllysine-residue acetyltransferase (EC:2.3.1.12); K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] (A)
MAFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEIL
VEEGTVATVGQTLITLDAPGYENMTFKGQEQDEPKEKENAQEVSKKEDGVAEAPQEAPSK
QTEVDPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKSDIDAFLAGGSAAAQKQEA
PAAQEEKAAAASAAQQPVVLEGEFPETREKMSGIRRAIAKAMVNSKHTAPHVTLMDEVDV
TKLVAHRKKFKEVAAEKGIKLTFLPYVVKALTSALREFPVLNTSIDDETEEVIYKHYYNI
GIAADTDRGLLVPVIKHADRKPIFALAKEINELATKAREGKLTPNEMKGASCTITNIGSA
GGQWFTPVINHPEVAILGIGRISEKPIVRDGEIVVAPVLALSLSFDHRMIDGATAQKALN
HIKRLLNDPELLLMEA

BLAST