GenomeNet

>gur:Gura_3453 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) DNA primase, small subunit (A)
MSRKVVAIGGRRLSLSNLEKELYPSYGFTKAHVLAYYRRIAPFILPHLQDRALTLKRYPE
GVEDAFFFEKRCPSHHPAWAKTAELRREDGERMTVCLVNDLETLIWVANLASLELHVPLA
RAGSPETPDAMVFDLDPGDEADILDCARVALILRDLLSRLRLASFVKTSGQKGLHVYVPL
NCPETTFEDTKTFSKAVAVILQKNYPDLVTARMAKDYRKAKIFINWSQNDAKATMICVYS
LRAREKPYVSFPLEWRELERLAGLGDPERLQVIHAEAVRRAEEKGDLFREVLVKKQRLPH
L

BLAST