GenomeNet

>gva:HMPREF0424_1094 elongation factor Tu domain-containing protein; K02358 elongation factor Tu (A)
MAKEKYERTKPHVNIGTIGHVDHGKTTLTAAISKVLHGEYPDLNPQYDFDQIDAAPEEKE
RGITINIAHIEYQTAERHYAHVDAPGHADYVKNMITGAAQMDGAILVVAATDGPMAQTRE
HVLLAKQVGVPKILVALNKCDMVDDPELIDLVEEEVRDLLEENGFDRDCPVIRTSAYGAL
HDDAPDHEKWVETVKELMKAVDEYIPTPTHDLDKPFLMPIEDVFTISGRGTVVTGRVERG
KLPINTPVEIVGLRPTQTTTVTSIETFHKQMDEAEAGDNTGLLLRGINRTDVERGQVVAA
PGSVTPHTKFEGEVYVLTKDEGGRHSPFFSNYRPQFYFRTTDVTGVITLPDGVEMVQPGD
HATFTVELIQAIAMEEGLTFAVREGGRTVGSGRVTKILA

BLAST