GenomeNet

>gvh:HMPREF9231_0063 BNR/Asp-box repeat-containing protein; K01186 sialidase-1 [EC:3.2.1.18] (A)
MERRSTKTTSLIEDIADIKGSEHTRFNHATIKITPSSEIKKYSENESGINRKDKNEEINQ
NEGIIGFKFVANSDCDLLDIKPAQKSQATAQQEHTTPIIKISIKEDAPLLSAQNLLEDSA
DANGAKEIALQMEDALGACDGREHDFAITYGSFGSRFYLDGYQCFASATNLGPQRVSEKA
AEVCAAQAESSQIYDFYYSNHLPNPEEIANSSTQAQPDIWFAGPTICARDIKRVSCKSSG
TLHIQFRLRGPGQHGVLFAAGTAGTKTNLESSEKISVYAGPEGIKITLIDYETCVKSVIE
AAASVDDGEWHDLIIRANRGATDIYVDGYSQSHNIGQFWFANIPELNAVSIGEDLRGVRL
MGEARIGGIYFSALTEGQIQRISRAKPLVTTALFDTGYAGSRSYRIPSLVKTRMGTLIAG
ADQRTSVSNDAPNHINFVIRRSTDGGKTWGPLQTVINMPGKNLGKLGASAIDSCPILDPA
GKSERINVLIDINPGGIGLTNCKTAVGVDACGRIKLIDRLGGNYAAAMNGSAAVKLPCDS
SEKECATKWLVFPDGSIKNCDSHNDLRNNSHSNQTCDSSTWNIWKSQEIASESQPLFAEK
TCYIAQIYSDDDGKTWSTPRLIDHMVKEPWMSFAGVCPGNGIVIRQSEKHYGRILVPFYC
SGQSKSHYSSGALISDDGGKTWNRGKMINEGRLINGKIVDPVTMQDDDATSSETVFVERK
NGDILAFFRNQNRSGCVGKAISHDCGETWSELIFDTSLPEIFSQPSATCFNSENADNADC
IAFANASQMMPYRGRGVVRFSYDGGKTWAKNVCINPLHHVYQCLSSSNKRTLQLLWERET
TGIYITAIDSNLWKQDNLQIDFKSNAKSLNNTDLDCIKNKINTSEKMKDLEEGSLTRTER
SQHGRDI

BLAST