GenomeNet

>gvh:HMPREF9231_0774 K00886 polyphosphate glucokinase [EC:2.7.1.63] | (GenBank) ROK family protein (A)
MIDTAQAFGVDIGGSGIKAAPVNLEKGEFAEPRYKILTPAVSTPQAVADIVRQQLEHFDV
PADVPVGIAFPAPIKPGKKLEFMANLDQSWIGVDVTEVFSEACGRPVTVVNDADAAGLAE
QHFGAAKDKDGLVIATTLGTGIGTALIYNGTLIPNTELGHIQLEKGKGDAEKYAASSVRE
KLDMGYKKWAKRLTKYYGLMEKYFNPDLFVVGGGVSRVSEKFLPHIDIKTPIVVASLHNE
AGIIGAAYYAMQQRNN

BLAST