GenomeNet

>gvi:gvip297 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (RefSeq) rbcS; ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (A)
MQTLPKKKFYETMSYLPPLTDAEIAKQIQYMLDKGYIPCVEFNETSEPTMVYWTMWKLPL
FSVRSPQEVLSEVNACRSSYPGCFIRVIGFDNIRQCQTMSFIVYKP

BLAST