GenomeNet

>gya:GYMC52_0636 alpha amylase catalytic region protein; K01176 alpha-amylase [EC:3.2.1.1] (A)
MGNRLFMLLVLPFLLFYAMPAAAAEKEERTWQDEAIYFIMVDRFNNMDPTNDQNVNVNDP
KGYFGGDLKGVTAKLDYIKEMGFTAIWLTPIFKNMPGGYHGYWIEDFYQVDPHFGTLGDL
KTLVKEAHKRDMKVILDFVANHVGYNHPWLHDPTKKDWFHPKKEIFDWNDQTQLENGWMY
GLPDLAQENPEVKTYLIDVAKWWIKETDIDGYRLDTVRHVPKSFWQEFAKEVKSVKKDFF
LLGEVWSDDPRYIAEYGKYGIDGFVDYPLYGAVKQSLARRDASLRPLYDVWEYNKTFYDR
PYLLGSFLDNHDTVRFTKLAIDNRNNPISRIKLAMTYLFTAPGIPIMYYGTEIAMNGGQD
PDNRRLMDFRADPEIIDYLKKIGPLRQQLPSLRRGDFTLLYEKDGMAVWKRQYEDETTVI
AINNTGETQHVHLTNDQLPKNKELRGFLLDDLVRGDDDGYDLVLDRETAEVYKLREKTGI
NIPFIAAIVAVYALFLLFLYLVKKRAKRIHE

BLAST