GenomeNet

>gya:GYMC52_3014 K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] | (GenBank) Protein-glutamine gamma-glutamyltransferase (A)
MIRVLSPINFDVSSSFSLPASEQRILDALVSSPKLYTYANKHQLRFEIALRDRIVRAAGE
LAKSRARFAIFRFSRCNSDFWTRDERGGFRLRPDVTASEAIQDIFVHSERYAFECATAIV
IVFYKAVLDVIDPAAFNRLFADLLLYDWHTDRDLGIQTKKDEHFLPGDCLYFKNPEFDPL
TPQWQGENAIYLGDGFFYGHGIGIQTADGIIAALNRKRKRGATKSAYLLPDITQVDFAYL
SQFARGFDEFRLPIRRPPFIVGTLGSATFLLR

BLAST